HLA-DQA1 Rabbit mAb, Clone: [ARC0564], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11252S
Article Name: HLA-DQA1 Rabbit mAb, Clone: [ARC0564], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11252S
Supplier Catalog Number: CNA11252S
Alternative Catalog Number: MBL-CNA11252S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 155-254 of human HLA-DQA1 (P01909).
Conjugation: Unconjugated
Alternative Names: DQA1, DQ-A1, CELIAC1, HLA-DQA, HLA-DQB1, HLA-DQA1*
Clonality: Monoclonal
Clone Designation: [ARC0564]
Molecular Weight: 28kDa
NCBI: 3117
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: EGVSETSFLSKSDHSFFKISYLTLLPSAEESYDCKVEHWGLDKPLLKHWEPEIPAPMSELTETVVCALGLSVGLVGIVVGTVFIIRGLRSVGASRHQGPL
Target: HLA-DQA1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200