[KO Validated] YAP1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA11264S
Article Name: |
[KO Validated] YAP1 Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA11264S |
Supplier Catalog Number: |
CNA11264S |
Alternative Catalog Number: |
MBL-CNA11264S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
IP, WB |
Species Reactivity: |
Human, Mouse |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1). |
Conjugation: |
Unconjugated |
Alternative Names: |
YAP, YKI, COB1, YAP2, YAP-1, YAP65 |
Clonality: |
Polyclonal |
Molecular Weight: |
54kDa |
NCBI: |
10413 |
Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,50% glycerol |
Sequence: |
PTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYS |
Target: |
YAP1 |
Application Dilute: |
WB: WB,1:500 - 1:2000|IP,1:500 - 1:1000 |