[KO Validated] YAP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11264S
Article Name: [KO Validated] YAP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11264S
Supplier Catalog Number: CNA11264S
Alternative Catalog Number: MBL-CNA11264S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IP, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 155-504 of human YAP1 (NP_001123617.1).
Conjugation: Unconjugated
Alternative Names: YAP, YKI, COB1, YAP2, YAP-1, YAP65
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 10413
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: PTAQHLRQSSFEIPDDVPLPAGWEMAKTSSGQRYFLNHIDQTTTWQDPRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLDPRLDPRFAMNQRISQSAPVKQPPPLAPQSPQGGVMGGSNSNQQQQMRLQQLQMEKERLRLKQQELLRQAMRNINPSTANSPKCQELALRSQLPTLEQDGGTQNPVSSPGMSQELRTMTTNSSDPFLNSGTYHSRDESTDSGLSMSSYS
Target: YAP1
Application Dilute: WB: WB,1:500 - 1:2000|IP,1:500 - 1:1000