SIRT1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11267P
Article Name: SIRT1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11267P
Supplier Catalog Number: CNA11267P
Alternative Catalog Number: MBL-CNA11267P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human SIRT1 (NP_036370.2).
Conjugation: Unconjugated
Alternative Names: SIR2, SIR2L1, SIR2alpha
Clonality: Polyclonal
Molecular Weight: 82kDa
NCBI: 23411
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: TILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIE
Target: SIRT1
Application Dilute: WB: WB,1:1000 - 1:5000|IHC-P,1:50 - 1:200