Cardiac troponin T (TNNT2) Rabbit pAb, Unconjugated, Polyclonal

Product Overview

• Article Name: Cardiac troponin T (TNNT2) Rabbit pAb, Unconjugated, Polyclonal
• Biozol Catalog Number: MBL-CNA1126S
• Supplier Catalog Number: CNA1126S
• Alternative Catalog Number: MBL-CNA1126S
• Manufacturer: MBL
• Host: Rabbit
• Category: Antikörper
• Application: ICC, IF, IHC-P, WB
• Species Reactivity: Mouse, Rat
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-120 of human Cardiac troponin T (Cardiac troponin T (TNNT2)) (NP_001001431.1).
• Conjugation: Unconjugated
• Alternative Names: CMH2, RCM3, TnTC, cTnT, CMD1D, CMPD2, LVNC6

Product Properties

• Clonality: Polyclonal
• Molecular Weight: 36kDa
• NCBI: 7139
• Buffer: PBS with 0.02% sodium azide,50% glycerol
• Source: Rabbit
• Purity: Affinity purification
• Form: PBS with 0.02% sodium azide,50% glycerol
• Sequence: MSDIEEVVEEYEEEEQEEAAVEEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLVPPKIPDGERVDFDDIHRKRMEKDLNELQALIEAHFENRKKEEEEL
• Target: TNNT2

Application Notes

• Application Dilute: WB: WB,1:1000 - 1:5000|IHC-P,1:100 - 1:200|IF/ICC,1:50 - 1:200