IDH2 Rabbit mAb, Clone: [ARC0567], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11270S
Article Name: IDH2 Rabbit mAb, Clone: [ARC0567], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11270S
Supplier Catalog Number: CNA11270S
Alternative Catalog Number: MBL-CNA11270S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 353-452 of human IDH2 (P48735).
Conjugation: Unconjugated
Alternative Names: IDH, IDP, IDHM, IDPM, ICD-M, IDH-2, D2HGA2, mNADP-IDH
Clonality: Monoclonal
Clone Designation: [ARC0567]
Molecular Weight: 51kDa
NCBI: 3418
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: RHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ
Target: IDH2
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200