[KO Validated] NADPH oxidase 4 (NOX4) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11274P
Article Name: [KO Validated] NADPH oxidase 4 (NOX4) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11274P
Supplier Catalog Number: CNA11274P
Alternative Catalog Number: MBL-CNA11274P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 479-578 of human NADPH oxidase 4 (NOX4) (NP_058627.2).
Conjugation: Unconjugated
Alternative Names: KOX, KOX-1, RENOX
Clonality: Polyclonal
Molecular Weight: 67kDa
NCBI: 50507
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: LHNKFWQENRPDYVNIQLYLSQTDGIQKIIGEKYHALNSRLFIGRPRWKLLFDEIAKYNRGKTVGVFCCGPNSLSKTLHKLSNQNNSYGTRFEYNKESFS
Target: NOX4
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200