PHPT1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1127S
Article Name: PHPT1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1127S
Supplier Catalog Number: CNA1127S
Alternative Catalog Number: MBL-CNA1127S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human PHPT1 (NP_054891.2).
Conjugation: Unconjugated
Alternative Names: PHP, PHP14, CGI-202, HSPC141, HEL-S-132P
Clonality: Polyclonal
Molecular Weight: 14kDa
NCBI: 29085
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
Target: PHPT1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200