LC3B Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11282S
Article Name: LC3B Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11282S
Supplier Catalog Number: CNA11282S
Alternative Catalog Number: MBL-CNA11282S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-125 of human LC3B (NP_073729.1).
Conjugation: Unconjugated
Alternative Names: LC3B, ATG8F, MAP1LC3B-a, MAP1A/1BLC3
Clonality: Polyclonal
Molecular Weight: 15kDa
NCBI: 81631
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPISEVYESEKDEDGFLYMVYASQETFGMKLSV
Target: MAP1LC3B
Application Dilute: WB: WB,1:100 - 1:500|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200