CD55 Rabbit mAb, Clone: [ARC0568], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11283S
Article Name: CD55 Rabbit mAb, Clone: [ARC0568], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11283S
Supplier Catalog Number: CNA11283S
Alternative Catalog Number: MBL-CNA11283S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 50-150 of human CD55 (P08174).
Conjugation: Unconjugated
Alternative Names: CR, TC, DAF, CROM, CHAPLE
Clonality: Monoclonal
Clone Designation: [ARC0568]
Molecular Weight: 41kDa
NCBI: 1604
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: EGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLK
Target: CD55
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200