GC1q R/C1QBP Rabbit mAb, Clone: [ARC2753], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11292S
Article Name: GC1q R/C1QBP Rabbit mAb, Clone: [ARC2753], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11292S
Supplier Catalog Number: CNA11292S
Alternative Catalog Number: MBL-CNA11292S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human GC1q R/C1QBP (Q07021).
Conjugation: Unconjugated
Alternative Names: p32, HABP1, gC1qR, GC1QBP, SF2p32, gC1Q-R, COXPD33, SF2AP32
Clonality: Monoclonal
Clone Designation: [ARC2753]
Molecular Weight: 31kDa
NCBI: 708
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: KTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAE
Target: C1QBP
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200