CXCR3 Rabbit mAb, Clone: [ARC0570], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11294S
Article Name: CXCR3 Rabbit mAb, Clone: [ARC0570], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11294S
Supplier Catalog Number: CNA11294S
Alternative Catalog Number: MBL-CNA11294S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-300 of human CXCR3 (P49682).
Conjugation: Unconjugated
Alternative Names: GPR9, MigR, CD182, CD183, Mig-R, CKR-L2, CMKAR3, IP10-R
Clonality: Monoclonal
Clone Designation: [ARC0570]
Molecular Weight: 41kDa
NCBI: 2833
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: ATHCQYNFPQVGRTALRVLQLVAGFLLPLLVMAYCYAHILAVLLVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAK
Target: CXCR3
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200