ANGPT2 Rabbit mAb, Clone: [ARC0571], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11306S
Article Name: ANGPT2 Rabbit mAb, Clone: [ARC0571], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11306S
Supplier Catalog Number: CNA11306S
Alternative Catalog Number: MBL-CNA11306S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human ANGPT2 (O15123).
Conjugation: Unconjugated
Alternative Names: ANG2, AGPT2, LMPHM10
Clonality: Monoclonal
Clone Designation: [ARC0571]
Molecular Weight: 57kDa
NCBI: 285
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: LTFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFVSQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYR
Target: ANGPT2
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200