AMACR Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1130T
Article Name: AMACR Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1130T
Supplier Catalog Number: CNA1130T
Alternative Catalog Number: MBL-CNA1130T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-138 of human AMACR (NP_055139.4).
Conjugation: Unconjugated
Alternative Names: RM, RACE, CBAS4, P504S, AMACRD
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 23600
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MALQGISVVELSGLAPGPFCAMVLADFGARVVRVDRPGSRYDVSRLGRGKRSLVLDLKQPRGAAVLRRLCKRSDVLLEPFRRGVMEKLQLGPEILQRENPRLIYARLSGFGQSGSFCRLAGHDINYLALSGVLSKIGR
Target: AMACR
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200