BMP4 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11315P
Article Name: BMP4 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11315P
Supplier Catalog Number: CNA11315P
Alternative Catalog Number: MBL-CNA11315P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human BMP4 (NP_001193.2).
Conjugation: Unconjugated
Alternative Names: ZYME, BMP2B, OFC11, BMP2B1, MCOPS6
Clonality: Polyclonal
Molecular Weight: 47kDa
NCBI: 652
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: QHVRISRSLPQGSGNWAQLRPLLVTFGHDGRGHALTRRRRAKRSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLN
Target: BMP4
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200