Caspase-3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11319P
Article Name: Caspase-3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11319P
Supplier Catalog Number: CNA11319P
Alternative Catalog Number: MBL-CNA11319P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 40-100 of human Caspase-3 (NP_116786.1).
Conjugation: Unconjugated
Alternative Names: CPP32, SCA-1, CPP32B
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 836
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: DYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELM
Target: CASP3
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:100 - 1:500