Caspase-8 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11324S
Article Name: Caspase-8 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11324S
Supplier Catalog Number: CNA11324S
Alternative Catalog Number: MBL-CNA11324S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 4-480 of mouse Caspase 8 (O89110).
Conjugation: Unconjugated
Alternative Names: MACH, Mch5, FLICE, CASP-8
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 12370
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: FEQQNHTLEVDSSSHKNYIPDEADFLLGMATVKNCVSYRDPVNGTWYIQSLCQSLRERCPQGDDILSILTGVNYDVSNKDDRRNKGKQMPQPTFTLRKKLFFPP
Target: Casp8
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200