MCM7 Rabbit mAb, Clone: [ARC0573], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11325S
Article Name: MCM7 Rabbit mAb, Clone: [ARC0573], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11325S
Supplier Catalog Number: CNA11325S
Alternative Catalog Number: MBL-CNA11325S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 600-700 of human MCM7 (P33993).
Conjugation: Unconjugated
Alternative Names: MCM2, CDC47, P85MCM, P1CDC47, PNAS146, PPP1R104, P1.1-MCM3
Clonality: Monoclonal
Clone Designation: [ARC0573]
Molecular Weight: 81kDa
NCBI: 4176
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: YTSARTLLAILRLSTALARLRMVDVVEKEDVNEAIRLMEMSKDSLLGDKGQTARTQRPADVIFATVRELVSGGRSVRFSEAEQRCVSRGFTPAQFQAALDE
Target: MCM7
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000