CDKN2A/p16INK4a Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA11337P
| Article Name: |
CDKN2A/p16INK4a Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA11337P |
| Supplier Catalog Number: |
CNA11337P |
| Alternative Catalog Number: |
MBL-CNA11337P |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human |
| Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-156 of human CDKN2A/p16INK4a (NP_000068.1). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
ARF, MLM, P14, P16, P19, CMM2, INK4, MTS1, TP16, CDK4I, CDKN2, INK4A, MTS-1, P14ARF, P19ARF, P16INK4, P16INK4A, P16-INK4A |
| Clonality: |
Polyclonal |
| Molecular Weight: |
8kDa/11kDa/12kDa/13kDa/16kDa/17kDa |
| NCBI: |
1029 |
| Buffer: |
PBS with 0.05% proclin300,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.05% proclin300,50% glycerol |
| Sequence: |
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD |
| Target: |
CDKN2A |
| Application Dilute: |
WB: WB,1:500 - 1:1000 |
