CDKN2A/p16INK4a Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA11337P
Article Name: |
CDKN2A/p16INK4a Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA11337P |
Supplier Catalog Number: |
CNA11337P |
Alternative Catalog Number: |
MBL-CNA11337P |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-156 of human CDKN2A/p16INK4a (NP_000068.1). |
Conjugation: |
Unconjugated |
Alternative Names: |
ARF, MLM, P14, P16, P19, CMM2, INK4, MTS1, TP16, CDK4I, CDKN2, INK4A, MTS-1, P14ARF, P19ARF, P16INK4, P16INK4A, P16-INK4A |
Clonality: |
Polyclonal |
Molecular Weight: |
8kDa/11kDa/12kDa/13kDa/16kDa/17kDa |
NCBI: |
1029 |
Buffer: |
PBS with 0.05% proclin300,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.05% proclin300,50% glycerol |
Sequence: |
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPD |
Target: |
CDKN2A |
Application Dilute: |
WB: WB,1:500 - 1:1000 |