p38 MAPK Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA11340T
| Article Name: |
p38 MAPK Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA11340T |
| Supplier Catalog Number: |
CNA11340T |
| Alternative Catalog Number: |
MBL-CNA11340T |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Human, Mouse, Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human p38 MAPK (NP_620581.1). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
RK, p38, CSBP, EXIP, Mxi2, CSBP1, CSBP2, CSPB1, PRKM14, PRKM15, SAPK2A, p38ALPHA |
| Clonality: |
Polyclonal |
| Molecular Weight: |
41kDa |
| NCBI: |
1432 |
| Buffer: |
PBS with 0.01% thimerosal,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.01% thimerosal,50% glycerol |
| Sequence: |
AQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES |
| Target: |
MAPK14 |
| Application Dilute: |
WB: WB,1:500 - 1:1000 |
