[KO Validated] beta-Catenin Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA11343S
Article Name: |
[KO Validated] beta-Catenin Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA11343S |
Supplier Catalog Number: |
CNA11343S |
Alternative Catalog Number: |
MBL-CNA11343S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
IP, WB |
Species Reactivity: |
Mouse |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 650-750 of human beta-Catenin (NP_001895.1). |
Conjugation: |
Unconjugated |
Alternative Names: |
EVR7, CTNNB, MRD19, NEDSDV, armadillo |
Clonality: |
Polyclonal |
Molecular Weight: |
85kDa |
NCBI: |
1499 |
Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,50% glycerol |
Sequence: |
GVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPV |
Target: |
CTNNB1 |
Application Dilute: |
WB: WB,1:500 - 1:2000|IP,1:50 - 1:200 |