[KO Validated] beta-Catenin Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA11343S
| Article Name: |
[KO Validated] beta-Catenin Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA11343S |
| Supplier Catalog Number: |
CNA11343S |
| Alternative Catalog Number: |
MBL-CNA11343S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IP, WB |
| Species Reactivity: |
Mouse |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 650-750 of human beta-Catenin (NP_001895.1). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
EVR7, CTNNB, MRD19, NEDSDV, armadillo |
| Clonality: |
Polyclonal |
| Molecular Weight: |
85kDa |
| NCBI: |
1499 |
| Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequence: |
GVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPV |
| Target: |
CTNNB1 |
| Application Dilute: |
WB: WB,1:500 - 1:2000|IP,1:50 - 1:200 |
