Ephrin B2 Rabbit mAb, Clone: [ARC0576], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11349S
Article Name: Ephrin B2 Rabbit mAb, Clone: [ARC0576], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11349S
Supplier Catalog Number: CNA11349S
Alternative Catalog Number: MBL-CNA11349S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Ephrin B2 (P52799).
Conjugation: Unconjugated
Alternative Names: HTKL, EPLG5, Htk-L, LERK5, ephrin-B2
Clonality: Monoclonal
Clone Designation: [ARC0576]
Molecular Weight: 37kDa
NCBI: 1948
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MAVRRDSVWKYCWGVLMVLCRTAISKSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLN
Target: EFNB2
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200