Doublecortin Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1134P
Article Name: Doublecortin Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1134P
Supplier Catalog Number: CNA1134P
Alternative Catalog Number: MBL-CNA1134P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 265-365 of human Doublecortin (NP_835365.1).
Conjugation: Unconjugated
Alternative Names: DC, DBCN, LISX, SCLH, XLIS
Clonality: Polyclonal
Molecular Weight: 41kDa
NCBI: 1641
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: SLDENECRVMKGNPSATAGPKASPTPQKTSAKSPGPMRRSKSPADSGNDQDANGTSSSQLSTPKSKQSPISTPTSPGSLRKHKDLYLPLSLDDSDSLGDSM
Target: DCX
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200