mTOR Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11355S
Article Name: mTOR Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11355S
Supplier Catalog Number: CNA11355S
Alternative Catalog Number: MBL-CNA11355S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 2400-2500 of human mTOR (NP_004949.1).
Conjugation: Unconjugated
Alternative Names: SKS, FRAP, FRAP1, FRAP2, RAFT1, RAPT1
Clonality: Polyclonal
Molecular Weight: 289kDa
NCBI: 2475
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: CHTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQI
Target: MTOR
Application Dilute: WB: WB,1:100 - 1:500|IF/ICC,1:50 - 1:200