GOT1 Rabbit mAb, Clone: [ARC0579], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11363S
Article Name: GOT1 Rabbit mAb, Clone: [ARC0579], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11363S
Supplier Catalog Number: CNA11363S
Alternative Catalog Number: MBL-CNA11363S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human GOT1 (NP_002070.1).
Conjugation: Unconjugated
Alternative Names: AST, AST1, SGOT, cCAT, GIG18, cAspAT, ASTQTL1
Clonality: Monoclonal
Clone Designation: [ARC0579]
Molecular Weight: 46kDa
NCBI: 2805
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: AAGFKDIRSYRYWDAEKRGLDLQGFLNDLENAPEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWAIRYFVSEGFE
Target: GOT1
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200