Myoglobin Rabbit mAb, Clone: [ARC0582], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11368S
Article Name: Myoglobin Rabbit mAb, Clone: [ARC0582], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11368S
Supplier Catalog Number: CNA11368S
Alternative Catalog Number: MBL-CNA11368S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 55-154 of human Myoglobin (P02144).
Conjugation: Unconjugated
Alternative Names: MYOSB, PVALB
Clonality: Monoclonal
Clone Designation: [ARC0582]
Molecular Weight: 17kDa
NCBI: 4151
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: EMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG
Target: MB
Application Dilute: WB: WB,1:500 - 1:2000