IL1beta Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11370T
Article Name: IL1beta Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11370T
Supplier Catalog Number: CNA11370T
Alternative Catalog Number: MBL-CNA11370T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF
Species Reactivity: Human
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-269 of human IL1beta (P01584).
Conjugation: Unconjugated
Alternative Names: IL-1, IL1F2, IL1beta, IL1-BETA
Clonality: Polyclonal
Molecular Weight: 31kDa
NCBI: 3553
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKGFRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTK
Target: IL1B
Application Dilute: WB: IF/ICC,1:50 - 1:200