c-Jun Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11378P
Article Name: c-Jun Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11378P
Supplier Catalog Number: CNA11378P
Alternative Catalog Number: MBL-CNA11378P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human c-Jun (NP_002219.1).
Conjugation: Unconjugated
Alternative Names: AP1, p39, AP-1, cJUN, c-Jun
Clonality: Polyclonal
Molecular Weight: 36kDa
NCBI: 3725
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MTAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCP
Target: JUN
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200