MCM7 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1138P
Article Name: MCM7 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1138P
Supplier Catalog Number: CNA1138P
Alternative Catalog Number: MBL-CNA1138P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-140 of human MCM7 (NP_005907.3).
Conjugation: Unconjugated
Alternative Names: MCM2, CDC47, P85MCM, P1CDC47, PNAS146, PPP1R104, P1.1-MCM3
Clonality: Polyclonal
Molecular Weight: 81kDa
NCBI: 4176
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: MALKDYALEKEKVKKFLQEFYQDDELGKKQFKYGNQLVRLAHREQVALYVDLDDVAEDDPELVDSICENARRYAKLFADAVQELLPQYKEREVVNKDVLDVYIEHRLMMEQRSRDPGMVRSPQNQYPAELMRRFELYFQG
Target: MCM7
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200|IP,1:100 - 1:500