delta-Catenin/p120 Catenin Rabbit mAb, Clone: [ARC0586], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11399S
Article Name: delta-Catenin/p120 Catenin Rabbit mAb, Clone: [ARC0586], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11399S
Supplier Catalog Number: CNA11399S
Alternative Catalog Number: MBL-CNA11399S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 869-968 of human delta-Catenin/p120 Catenin (O60716).
Conjugation: Unconjugated
Alternative Names: CAS, p120, BCDS2, CTNND, P120CAS, P120CTN, p120(CAS), p120(CTN)
Clonality: Monoclonal
Clone Designation: [ARC0586]
Molecular Weight: 108kDa
NCBI: 1500
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: TLPLIDRNQKSDKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNRTLDRSGDLGDMEPLKGTTPLMQDEGQESLEEELDVLVLDDEGGQVSYPSMQKI
Target: CTNND1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IP,1:500 - 1:1000