HLA-A Rabbit mAb, Clone: [ARC0588], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11406S
Article Name: HLA-A Rabbit mAb, Clone: [ARC0588], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11406S
Supplier Catalog Number: CNA11406S
Alternative Catalog Number: MBL-CNA11406S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, IP, WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HLA-A (P04439).
Conjugation: Unconjugated
Alternative Names: HLAA
Clonality: Monoclonal
Clone Designation: [ARC0588]
Molecular Weight: 41kDa
NCBI: 3105
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRV
Target: HLA-A
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IP,1:1000 - 1:5000