MMP3 Rabbit mAb, Clone: [ARC51098], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11418P
Article Name: MMP3 Rabbit mAb, Clone: [ARC51098], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11418P
Supplier Catalog Number: CNA11418P
Alternative Catalog Number: MBL-CNA11418P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 385-477 of human MMP3 (NP_002413.1).
Conjugation: Unconjugated
Alternative Names: SL-1, STMY, STR1, CHDS6, MMP-3, STMY1
Clonality: Monoclonal
Clone Designation: [ARC51098]
Molecular Weight: 54kDa
NCBI: 4314
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: VRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEPGFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC
Target: MMP3
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200