CDK1 Rabbit mAb, Clone: [ARC50607], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11420P
Article Name: CDK1 Rabbit mAb, Clone: [ARC50607], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11420P
Supplier Catalog Number: CNA11420P
Alternative Catalog Number: MBL-CNA11420P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IP, WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 198-297 of human CDK1 (NP_001777.1).
Conjugation: Unconjugated
Alternative Names: CDC2, CDC28A, P34CDC2
Clonality: Monoclonal
Clone Designation: [ARC50607]
Molecular Weight: 34kDa
NCBI: 983
Buffer: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,0.05% BSA,50% glycerol
Sequence: ATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM
Target: CDK1
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000