Vimentin Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11423T
Article Name: Vimentin Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11423T
Supplier Catalog Number: CNA11423T
Alternative Catalog Number: MBL-CNA11423T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human Vimentin (NP_003371.2).
Conjugation: Unconjugated
Alternative Names: CTRCT30,HEL113,Vimentin,VIM,vimentin
Clonality: Polyclonal
Molecular Weight: 54kDa
NCBI: 7431
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: EAANRNNDALRQAKQESTEYRRQVQSLTCEVDALKGTNESLERQMREMEENFAVEAANYQDTIGRLQDEIQNMKEEMARHLREYQDLLNVKMALDIEIATY
Target: VIM
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200