ASC/TMS1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11433T
Article Name: ASC/TMS1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11433T
Supplier Catalog Number: CNA11433T
Alternative Catalog Number: MBL-CNA11433T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-50 of human ASC/TMS1 (NP_037390.2).
Conjugation: Unconjugated
Alternative Names: ASC, TMS, TMS1, CARD5, TMS-1
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 29108
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: MGRARDAILDALENLTAEELKKFKLKLLSVPLREGYGRIPRGALLSMDAL
Target: PYCARD
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200