MAP1LC3A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11438S
Article Name: MAP1LC3A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11438S
Supplier Catalog Number: CNA11438S
Alternative Catalog Number: MBL-CNA11438S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MAP1LC3A (NP_115903.1).
Conjugation: Unconjugated
Alternative Names: LC3, LC3A, ATG8E, MAP1ALC3, MAP1BLC3
Clonality: Polyclonal
Molecular Weight: 14kDa
NCBI: 84557
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYE
Target: MAP1LC3A
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200