SH2D1A Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1143S
Article Name: SH2D1A Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1143S
Supplier Catalog Number: CNA1143S
Alternative Catalog Number: MBL-CNA1143S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-128 of human SH2D1A (NP_002342.1).
Conjugation: Unconjugated
Alternative Names: LYP, SAP, XLP, DSHP, EBVS, IMD5, XLPD, MTCP1, XLPD1, SAP/SH2D1A
Clonality: Polyclonal
Molecular Weight: 14kDa
NCBI: 4068
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: MDAVAVYHGKISRETGEKLLLATGLDGSYLLRDSESVPGVYCLCVLYHGYIYTYRVSQTETGSWSAETAPGVHKRYFRKIKNLISAFQKPDQGIVIPLQYPVEKKSSARSTQGTTGIREDPDVCLKAP
Target: SH2D1A
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200