GCLM Rabbit mAb, Clone: [ARC0597], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11444S
Article Name: GCLM Rabbit mAb, Clone: [ARC0597], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11444S
Supplier Catalog Number: CNA11444S
Alternative Catalog Number: MBL-CNA11444S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 175-274 of human GCLM (P48507).
Conjugation: Unconjugated
Alternative Names: GLCLR
Clonality: Monoclonal
Clone Designation: [ARC0597]
Molecular Weight: 31kDa
NCBI: 2730
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: LYQWAQVKPNSNQVNLASCCVMPPDLTAFAKQFDIQLLTHNDPKELLSEASFQEALQESIPDIQAHEWVPLWLLRYSVIVKSRGIIKSKGYILQAKRRGS
Target: GCLM
Application Dilute: WB: WB,1:500 - 1:1000