ALDOA Rabbit mAb, Clone: [ARC0598], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11445S
Article Name: ALDOA Rabbit mAb, Clone: [ARC0598], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11445S
Supplier Catalog Number: CNA11445S
Alternative Catalog Number: MBL-CNA11445S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Aldolase (P04075).
Conjugation: Unconjugated
Alternative Names: ALDA, GSD12, HEL-S-87p
Clonality: Monoclonal
Clone Designation: [ARC0598]
Molecular Weight: 39kDa
NCBI: 226
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYRQLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKS
Target: ALDOA
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200