Caspase-8 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11450T
Article Name: Caspase-8 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11450T
Supplier Catalog Number: CNA11450T
Alternative Catalog Number: MBL-CNA11450T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human Caspase-8 (NP_203519.1).
Conjugation: Unconjugated
Alternative Names: CAP4, MACH, MCH5, FLICE, ALPS2B, Casp-8
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 841
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: QLMDHSNMDCFICCILSHGDKGIIYGTDGQEAPIYELTSQFTGLKCPSLAGKPKVFFIQACQGDNYQKGIPVETDSEEQPYLEMDLSSPQTRYIPDEADFL
Target: CASP8
Application Dilute: WB: WB,1:500 - 1:1000