DAP Kinase 1 (DAPK1) Rabbit mAb, Clone: [ARC0601], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11459S
Article Name: DAP Kinase 1 (DAPK1) Rabbit mAb, Clone: [ARC0601], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11459S
Supplier Catalog Number: CNA11459S
Alternative Catalog Number: MBL-CNA11459S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Mouse
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 250-350 of human DAP Kinase 1 (DAPK1) (P53355).
Conjugation: Unconjugated
Alternative Names: DAPK, ROCO3
Clonality: Monoclonal
Clone Designation: [ARC0601]
Molecular Weight: 160kDa
NCBI: 1612
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: DFIRRLLVKDPKKRMTIQDSLQHPWIKPKDTQQALSRKASAVNMEKFKKFAARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAIIH
Target: DAPK1
Application Dilute: WB: WB,1:500 - 1:1000