TRADD Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA1145S
Article Name: |
TRADD Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA1145S |
Supplier Catalog Number: |
CNA1145S |
Alternative Catalog Number: |
MBL-CNA1145S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Human |
Immunogen: |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-312 of human TRADD (NP_003780.1). |
Conjugation: |
Unconjugated |
Alternative Names: |
9130005N23Rik |
Clonality: |
Polyclonal |
Molecular Weight: |
34kDa |
NCBI: |
8717 |
Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,50% glycerol |
Sequence: |
MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQMLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQHSVPLQLELRAGAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGARGGDGEVASAPLQPPVPSLSEVKPPPPPPPAQTFLFQGQPVVNRPLSLKDQQTFARSVGLKWRKVGRSLQRGCRALRDPALDSLAY |
Target: |
Tradd |
Application Dilute: |
WB: WB,1:1000 - 1:5000 |