LAMP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11468S
Article Name: LAMP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11468S
Supplier Catalog Number: CNA11468S
Alternative Catalog Number: MBL-CNA11468S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 51-270 of human LAMP1 (NP_005552.3).
Conjugation: Unconjugated
Alternative Names: LAMPA, CD107a, LGP120
Clonality: Polyclonal
Molecular Weight: 45kDa
NCBI: 3916
Buffer: PBS with 0.02% sodium azide,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,50% glycerol
Sequence: SVNYDTKSGPKNMTFDLPSDATVVLNRSSCGKENTSDPSLVIAFGRGHTLTLNFTRNATRYSVQLMSFVYNLSDTHLFPNASSKEIKTVESITDIRADIDKKYRCVSGTQVHMNNVTVTLHDATIQAYLSNSSFSRGETRCEQDRPSPTTAPPAPPSPSPSPVPKSPSVDKYNVSGTNGTCLLASMGLQLNLTYERKDNTTVTRLLNINPNKTSASGSCG
Target: LAMP1
Application Dilute: WB: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200