MAD2/MAD2L1 Rabbit mAb, Clone: [ARC0603], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11469S
Article Name: MAD2/MAD2L1 Rabbit mAb, Clone: [ARC0603], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11469S
Supplier Catalog Number: CNA11469S
Alternative Catalog Number: MBL-CNA11469S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 70-150 of human MAD2/MAD2L1 (Q13257).
Conjugation: Unconjugated
Alternative Names: MAD2, HSMAD2
Clonality: Monoclonal
Clone Designation: [ARC0603]
Molecular Weight: 24kDa
NCBI: 4085
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: EQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRSVIRQITATVTFLPLLEVSCS
Target: MAD2L1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200