Smad3 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA11471S
| Article Name: |
Smad3 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: |
MBL-CNA11471S |
| Supplier Catalog Number: |
CNA11471S |
| Alternative Catalog Number: |
MBL-CNA11471S |
| Manufacturer: |
MBL |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Species Reactivity: |
Rat |
| Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Smad3 (NP_005893.1). |
| Conjugation: |
Unconjugated |
| Alternative Names: |
LDS3, mad3, LDS1C, MADH3, JV15-2, hMAD-3, hSMAD3, HSPC193, HsT17436 |
| Clonality: |
Polyclonal |
| Molecular Weight: |
48kDa |
| NCBI: |
4088 |
| Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
| Source: |
Rabbit |
| Purity: |
Affinity purification |
| Form: |
PBS with 0.02% sodium azide,50% glycerol |
| Sequence: |
FPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHA |
| Target: |
SMAD3 |
| Application Dilute: |
WB: WB,1:500 - 1:2000 |
