Smad3 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
MBL-CNA11471S
Article Name: |
Smad3 Rabbit pAb, Unconjugated, Polyclonal |
Biozol Catalog Number: |
MBL-CNA11471S |
Supplier Catalog Number: |
CNA11471S |
Alternative Catalog Number: |
MBL-CNA11471S |
Manufacturer: |
MBL |
Host: |
Rabbit |
Category: |
Antikörper |
Application: |
WB |
Species Reactivity: |
Rat |
Immunogen: |
A synthetic peptide corresponding to a sequence within amino acids 150-250 of human Smad3 (NP_005893.1). |
Conjugation: |
Unconjugated |
Alternative Names: |
LDS3, mad3, LDS1C, MADH3, JV15-2, hMAD-3, hSMAD3, HSPC193, HsT17436 |
Clonality: |
Polyclonal |
Molecular Weight: |
48kDa |
NCBI: |
4088 |
Buffer: |
PBS with 0.02% sodium azide,50% glycerol |
Source: |
Rabbit |
Purity: |
Affinity purification |
Form: |
PBS with 0.02% sodium azide,50% glycerol |
Sequence: |
FPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHA |
Target: |
SMAD3 |
Application Dilute: |
WB: WB,1:500 - 1:2000 |