MCM3 Rabbit mAb, Clone: [ARC0607], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11475S
Article Name: MCM3 Rabbit mAb, Clone: [ARC0607], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11475S
Supplier Catalog Number: CNA11475S
Alternative Catalog Number: MBL-CNA11475S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, IP, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MCM3 (P25205).
Conjugation: Unconjugated
Alternative Names: HCC5, P1.h, RLFB, P1-MCM3
Clonality: Monoclonal
Clone Designation: [ARC0607]
Molecular Weight: 91kDa
NCBI: 4172
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAFEELVAFQRALKDFVASIDATYAKQYEEFYV
Target: MCM3
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200|IP,1:500 - 1:1000