CES1 Rabbit mAb, Clone: [ARC0613], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11478S
Article Name: CES1 Rabbit mAb, Clone: [ARC0613], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11478S
Supplier Catalog Number: CNA11478S
Alternative Catalog Number: MBL-CNA11478S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human CES1 (P23141).
Conjugation: Unconjugated
Alternative Names: CEH, REH, TGH, ACAT, CE-1, CES2, HMSE, SES1, HMSE1, PCE-1, hCE-1
Clonality: Monoclonal
Clone Designation: [ARC0613]
Molecular Weight: 63kDa
NCBI: 1066
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: MWLRAFILATLSASAAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPLGPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLSEL
Target: CES1
Application Dilute: WB: WB,1:500 - 1:1000|IF/ICC,1:50 - 1:200