NEUROD1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA1147P
Article Name: NEUROD1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA1147P
Supplier Catalog Number: CNA1147P
Alternative Catalog Number: MBL-CNA1147P
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: WB
Species Reactivity: Human, Rat
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 160-356 of human NEUROD1 (NP_002491.3).
Conjugation: Unconjugated
Alternative Names: T2D, BETA2, BHF-1, MODY6, NEUROD, bHLHa3
Clonality: Polyclonal
Molecular Weight: 40kDa
NCBI: 4760
Buffer: PBS with 0.05% proclin300,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.05% proclin300,50% glycerol
Sequence: GKSPDLVSFVQTLCKGLSQPTTNLVAGCLQLNPRTFLPEQNQDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFTMHYPAATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQLNAIFHD
Target: NEUROD1
Application Dilute: WB: WB,1:100 - 1:500