Mast Cell Chymase (CMA1) Rabbit mAb, Clone: [ARC0614], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11480S
Article Name: Mast Cell Chymase (CMA1) Rabbit mAb, Clone: [ARC0614], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11480S
Supplier Catalog Number: CNA11480S
Alternative Catalog Number: MBL-CNA11480S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 148-247 of human Mast Cell Chymase (CMA1) (CMA1) (P23946).
Conjugation: Unconjugated
Alternative Names: CYH, MCT1, chymase
Clonality: Monoclonal
Clone Designation: [ARC0614]
Molecular Weight: 27kDa
NCBI: 1215
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: GWGRTGVLKPGSDTLQEVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVAQGIVSYGRSDAKPPAVFTRISHYRPWINQILQAN
Target: CMA1
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200