KEAP1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: MBL-CNA11484T
Article Name: KEAP1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: MBL-CNA11484T
Supplier Catalog Number: CNA11484T
Alternative Catalog Number: MBL-CNA11484T
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-400 of human KEAP1 (NP_036421.2).
Conjugation: Unconjugated
Alternative Names: INrf2, KLHL19
Clonality: Polyclonal
Molecular Weight: 70kDa
NCBI: 9817
Buffer: PBS with 0.01% thimerosal,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.01% thimerosal,50% glycerol
Sequence: YLVKIFEELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMT
Target: KEAP1
Application Dilute: WB: WB,1:500 - 1:1000|IHC-P,1:50 - 1:200