[KO Validated] FGF2 Rabbit mAb, Clone: [ARC0618], Unconjugated, Monoclonal

Catalog Number: MBL-CNA11488S
Article Name: [KO Validated] FGF2 Rabbit mAb, Clone: [ARC0618], Unconjugated, Monoclonal
Biozol Catalog Number: MBL-CNA11488S
Supplier Catalog Number: CNA11488S
Alternative Catalog Number: MBL-CNA11488S
Manufacturer: MBL
Host: Rabbit
Category: Antikörper
Application: ICC, IF, IHC-P, WB
Species Reactivity: Human, Mouse, Rat
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 100-200 of human FGF2 (NP_001997.5).
Conjugation: Unconjugated
Alternative Names: BFGF, FGFB, FGF-2, HBGF-2
Clonality: Monoclonal
Clone Designation: [ARC0618]
Molecular Weight: 31kDa
NCBI: 2247
Buffer: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Source: Rabbit
Purity: Affinity purification
Form: PBS with 0.02% sodium azide,0.05% BSA,50% glycerol
Sequence: RAPERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAE
Target: FGF2
Application Dilute: WB: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|IF/ICC,1:50 - 1:200